Lineage for d5ffga1 (5ffg A:1-439)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2066356Superfamily b.69.8: Integrin alpha N-terminal domain [69318] (2 families) (S)
  5. 2066357Family b.69.8.1: Integrin alpha N-terminal domain [69319] (2 protein domains)
  6. 2066399Protein automated matches [254690] (1 species)
    not a true protein
  7. 2066400Species Human (Homo sapiens) [TaxId:9606] [255892] (11 PDB entries)
  8. 2285518Domain d5ffga1: 5ffg A:1-439 [328819]
    Other proteins in same PDB: d5ffga2
    automated match to d1m1xa4
    complexed with bma, ca, man, mes, nag, peg, so4

Details for d5ffga1

PDB Entry: 5ffg (more details), 2.25 Å

PDB Description: crystal structure of integrin alpha v beta 6 head
PDB Compounds: (A:) Integrin alpha-V

SCOPe Domain Sequences for d5ffga1:

Sequence, based on SEQRES records: (download)

>d5ffga1 b.69.8.1 (A:1-439) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fnldvdspaeysgpegsyfgfavdffvpsassrmfllvgapkanttqpgiveggqvlkcd
wsstrrcqpiefdatgnrdyakddplefkshqwfgasvrskqdkilacaplyhwrtemkq
erepvgtcflqdgtktveyapcrsqdidadgqgfcqggfsidftkadrvllggpgsfywq
gqlisdqvaeivskydpnvysikynnqlatrtaqaifddsylgysvavgdfngdgiddfv
sgvpraartlgmvyiydgknmsslynftgeqmaayfgfsvaatdingddyadvfigaplf
mdrgsdgklqevgqvsvslqrasgdfqttklngfevfarfgsaiaplgdldqdgfndiai
aapyggedkkgivyifngrstglnavpsqilegqwaarsgcppsfgysmkgatdidkngy
pdlivgafgvdrailyrar

Sequence, based on observed residues (ATOM records): (download)

>d5ffga1 b.69.8.1 (A:1-439) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fnldvdspaeysgpegsyfgfavdffvpsrmfllvgapkanttqpgiveggqvlkcdwss
trrcqpiefdatgnrdyakddplefkshqwfgasvrskqdkilacaplyhwrtemkqere
pvgtcflqdgtktveyapcrsqdidadgqgfcqggfsidftkadrvllggpgsfywqgql
isdqvaeivskydpnvysikynnqlatrtaqaifddsylgysvavgdfngdgiddfvsgv
praartlgmvyiydgknmsslynftgeqmaayfgfsvaatdingddyadvfigaplfmdr
gsdgklqevgqvsvslqrasgdfqttklngfevfarfgsaiaplgdldqdgfndiaiaap
yggedkkgivyifngrstglnavpsqilegqwaarsgcppsfgysmkgatdidkngypdl
ivgafgvdrailyrar

SCOPe Domain Coordinates for d5ffga1:

Click to download the PDB-style file with coordinates for d5ffga1.
(The format of our PDB-style files is described here.)

Timeline for d5ffga1:

  • d5ffga1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-25