SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ffga1 (5ffg A:1-439)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2066356Superfamily b.69.8: Integrin alpha N-terminal domain [69318] (2 families) (S)
  5. 2066357Family b.69.8.1: Integrin alpha N-terminal domain [69319] (2 protein domains)
  6. 2066399Protein automated matches [254690] (1 species)
    not a true protein
  7. 2066400Species Human (Homo sapiens) [TaxId:9606] [255892] (11 PDB entries)
  8. 2285518Domain d5ffga1: 5ffg A:1-439 [328819]
    Other proteins in same PDB: d5ffga2
    automated match to d1m1xa4
    complexed with bma, ca, man, mes, nag, peg, so4

Details for d5ffga1

PDB Entry: 5ffg (more details), 2.25 Å

PDB Description: crystal structure of integrin alpha v beta 6 head
PDB Compounds: (A:) Integrin alpha-V

SCOPe Domain Sequences for d5ffga1:

Sequence, based on SEQRES records: (download)

>d5ffga1 b.69.8.1 (A:1-439) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fnldvdspaeysgpegsyfgfavdffvpsassrmfllvgapkanttqpgiveggqvlkcd
wsstrrcqpiefdatgnrdyakddplefkshqwfgasvrskqdkilacaplyhwrtemkq
erepvgtcflqdgtktveyapcrsqdidadgqgfcqggfsidftkadrvllggpgsfywq
gqlisdqvaeivskydpnvysikynnqlatrtaqaifddsylgysvavgdfngdgiddfv
sgvpraartlgmvyiydgknmsslynftgeqmaayfgfsvaatdingddyadvfigaplf
mdrgsdgklqevgqvsvslqrasgdfqttklngfevfarfgsaiaplgdldqdgfndiai
aapyggedkkgivyifngrstglnavpsqilegqwaarsgcppsfgysmkgatdidkngy
pdlivgafgvdrailyrar

Sequence, based on observed residues (ATOM records): (download)

>d5ffga1 b.69.8.1 (A:1-439) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fnldvdspaeysgpegsyfgfavdffvpsrmfllvgapkanttqpgiveggqvlkcdwss
trrcqpiefdatgnrdyakddplefkshqwfgasvrskqdkilacaplyhwrtemkqere
pvgtcflqdgtktveyapcrsqdidadgqgfcqggfsidftkadrvllggpgsfywqgql
isdqvaeivskydpnvysikynnqlatrtaqaifddsylgysvavgdfngdgiddfvsgv
praartlgmvyiydgknmsslynftgeqmaayfgfsvaatdingddyadvfigaplfmdr
gsdgklqevgqvsvslqrasgdfqttklngfevfarfgsaiaplgdldqdgfndiaiaap
yggedkkgivyifngrstglnavpsqilegqwaarsgcppsfgysmkgatdidkngypdl
ivgafgvdrailyrar

SCOPe Domain Coordinates for d5ffga1:

Click to download the PDB-style file with coordinates for d5ffga1.
(The format of our PDB-style files is described here.)

Timeline for d5ffga1:

  • d5ffga1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-25