SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5aoha_ (5aoh A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208774Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2208775Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2209498Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2209499Protein automated matches [190159] (14 species)
    not a true protein
  7. 2285514Species Serratia sp. [TaxId:104623] [328815] (1 PDB entry)
  8. 2285515Domain d5aoha_: 5aoh A: [328816]
    automated match to d2q17e_
    complexed with k

Details for d5aoha_

PDB Entry: 5aoh (more details), 1.8 Å

PDB Description: crystal structure of carf
PDB Compounds: (A:) carf

SCOPe Domain Sequences for d5aoha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5aoha_ d.169.1.0 (A:) automated matches {Serratia sp. [TaxId: 104623]}
ilpidevnvdggdfyvglvfgkedyaahanthltpfsimrtevtyhqyqalqawaetrgy
qisggcngatfedcwpsekdggrhpvtnvswwdavifanalsaqhnlqpyyvtadgqalk
ippeegtdrgirenpqasgyrlptlaewqvaarggnkglsdgtygsryagkdqpasvanl
pvsgtqtfstlpvaskqpnslglydmsgnvsewlnenyavkggkkmyyfcggsymdrvgs
lascdvhtpgfamsdigfrlvrpid

SCOPe Domain Coordinates for d5aoha_:

Click to download the PDB-style file with coordinates for d5aoha_.
(The format of our PDB-style files is described here.)

Timeline for d5aoha_:

  • d5aoha_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-25