Lineage for d5aoha_ (5aoh A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208774Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2208775Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2209498Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2209499Protein automated matches [190159] (15 species)
    not a true protein
  7. 2285514Species Serratia sp. [TaxId:104623] [328815] (1 PDB entry)
  8. 2285515Domain d5aoha_: 5aoh A: [328816]
    automated match to d2q17e_
    complexed with k

Details for d5aoha_

PDB Entry: 5aoh (more details), 1.8 Å

PDB Description: crystal structure of carf
PDB Compounds: (A:) carf

SCOPe Domain Sequences for d5aoha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5aoha_ d.169.1.0 (A:) automated matches {Serratia sp. [TaxId: 104623]}
ilpidevnvdggdfyvglvfgkedyaahanthltpfsimrtevtyhqyqalqawaetrgy
qisggcngatfedcwpsekdggrhpvtnvswwdavifanalsaqhnlqpyyvtadgqalk
ippeegtdrgirenpqasgyrlptlaewqvaarggnkglsdgtygsryagkdqpasvanl
pvsgtqtfstlpvaskqpnslglydmsgnvsewlnenyavkggkkmyyfcggsymdrvgs
lascdvhtpgfamsdigfrlvrpid

SCOPe Domain Coordinates for d5aoha_:

Click to download the PDB-style file with coordinates for d5aoha_.
(The format of our PDB-style files is described here.)

Timeline for d5aoha_:

  • d5aoha_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-25