SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5e7yb_ (5e7y B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005023Protein Cytochrome P450 bm-3 [48268] (1 species)
  7. 2005024Species Bacillus megaterium [TaxId:1404] [48269] (76 PDB entries)
    Uniprot P14779
  8. 2285513Domain d5e7yb_: 5e7y B: [328814]
    automated match to d2uwha_
    complexed with gol, hem

Details for d5e7yb_

PDB Entry: 5e7y (more details), 2 Å

PDB Description: crystal structure of p450 bm3 heme domain m7 variant
PDB Compounds: (B:) Bifunctional P-450/NADPH-P450 reductase

SCOPe Domain Sequences for d5e7yb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e7yb_ a.104.1.1 (B:) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]}
empqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikeacd
esrfdknlsqalkfvrdfagdglatswtheknwkkahnillpsfsqqamkgyhammvdia
vqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvralde
amnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngkdp
etgeplddeniryqiitfliaghettsgllsfalyflgknphvlqkaaeeaarvlvdpvp
sykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelsvlipqlhrd
ktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkhfdf
edhtnyeldiketltlkpegfvvkakskkipl

SCOPe Domain Coordinates for d5e7yb_:

Click to download the PDB-style file with coordinates for d5e7yb_.
(The format of our PDB-style files is described here.)

Timeline for d5e7yb_:

  • d5e7yb_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-25