Lineage for d5e7ya_ (5e7y A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005023Protein Cytochrome P450 bm-3 [48268] (2 species)
  7. 2005024Species Bacillus megaterium [TaxId:1404] [48269] (76 PDB entries)
    Uniprot P14779
  8. 2285512Domain d5e7ya_: 5e7y A: [328813]
    automated match to d2uwha_
    complexed with gol, hem

Details for d5e7ya_

PDB Entry: 5e7y (more details), 2 Å

PDB Description: crystal structure of p450 bm3 heme domain m7 variant
PDB Compounds: (A:) Bifunctional P-450/NADPH-P450 reductase

SCOPe Domain Sequences for d5e7ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e7ya_ a.104.1.1 (A:) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]}
mpqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikeacde
srfdknlsqalkfvrdfagdglatswtheknwkkahnillpsfsqqamkgyhammvdiav
qlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvraldea
mnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngkdpe
tgeplddeniryqiitfliaghettsgllsfalyflgknphvlqkaaeeaarvlvdpvps
ykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelsvlipqlhrdk
tiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkhfdfe
dhtnyeldiketltlkpegfvvkakskkipl

SCOPe Domain Coordinates for d5e7ya_:

Click to download the PDB-style file with coordinates for d5e7ya_.
(The format of our PDB-style files is described here.)

Timeline for d5e7ya_:

  • d5e7ya_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-25