SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5aana_ (5aan A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1994319Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1994320Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1994753Family a.39.1.5: Calmodulin-like [47502] (24 protein domains)
    Duplication: made with two pairs of EF-hands
  6. 1995301Protein automated matches [190064] (20 species)
    not a true protein
  7. 1995335Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [258881] (5 PDB entries)
  8. 2285511Domain d5aana_: 5aan A: [328812]
    automated match to d2lcpa_
    complexed with ca, pg0, xoc

Details for d5aana_

PDB Entry: 5aan (more details), 1.6 Å

PDB Description: crystal structure of frq bound to a ligand
PDB Compounds: (A:) cg5907-pa, isoform a

SCOPe Domain Sequences for d5aana_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5aana_ a.39.1.5 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
kknsklkqdtidrlttdtyftekeirqwhkgflkdcpngllteqgfikiykqffpdgdps
kfaslvfrvfdenndgaiefeefiralsitsrgnldeklhwafrlydvdndgyitreemy
nivdaiyqmvgqqpqtedentpqkrvdkifdqmdknhddrltleefregskadprmvqal
slg

SCOPe Domain Coordinates for d5aana_:

Click to download the PDB-style file with coordinates for d5aana_.
(The format of our PDB-style files is described here.)

Timeline for d5aana_:

  • d5aana_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-25