SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hiab_ (5hia B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2128255Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2128256Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2128257Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 protein domains)
  6. 2128349Protein Hypoxanthine-guanine PRTase (HGPRTase) [53283] (3 species)
  7. 2128350Species Human (Homo sapiens) [TaxId:9606] [53284] (18 PDB entries)
  8. 2285510Domain d5hiab_: 5hia B: [328811]
    automated match to d4raoa_
    complexed with mg, ypg

Details for d5hiab_

PDB Entry: 5hia (more details), 1.77 Å

PDB Description: human hypoxanthine-guanine phosphoribosyltransferase in complex with [3r,4r]-4-guanin-9-yl-3-((s)-2-hydroxy-2-phosphonoethyl)oxy-1-n- (phosphonopropionyl)pyrrolidine
PDB Compounds: (B:) hypoxanthine-guanine phosphoribosyltransferase

SCOPe Domain Sequences for d5hiab_:

Sequence, based on SEQRES records: (download)

>d5hiab_ c.61.1.1 (B:) Hypoxanthine-guanine PRTase (HGPRTase) {Human (Homo sapiens) [TaxId: 9606]}
rspgvvisddepgydldlfaipnhyaedlervfiphglimdrterlardvmkemgghhiv
alcvlkggykffadlldyikalnrnsdrsipmtvdfirlksycndqstgdikviggddls
tltgknvlivediidtgktmqtllslvrqynpkmvkvasllvkrtprsvgykpdfvgfei
pdkfvvgyaldyneyfrdlnhvavisetgkakyka

Sequence, based on observed residues (ATOM records): (download)

>d5hiab_ c.61.1.1 (B:) Hypoxanthine-guanine PRTase (HGPRTase) {Human (Homo sapiens) [TaxId: 9606]}
rspgvvisddepgydldlfaipnhyaedlervfiphglimdrterlardvmkemgghhiv
alcvlkggykffadlldyikalnrnsdrsipmtvdfirlkkviggddlstltgknvlive
diidtgktmqtllslvrqynpkmvkvasllvkrtprsvgykpdfvgfeipdkfvvgyald
yneyfrdlnhvavisetgkakyka

SCOPe Domain Coordinates for d5hiab_:

Click to download the PDB-style file with coordinates for d5hiab_.
(The format of our PDB-style files is described here.)

Timeline for d5hiab_:

  • d5hiab_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-19