Lineage for d2gsra2 (2gsr A:1-76)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 244778Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 244779Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 244918Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (15 proteins)
  6. 245100Protein Class pi GST [81358] (3 species)
  7. 245196Species Pig (Sus scrofa) [TaxId:9823] [52865] (1 PDB entry)
  8. 245197Domain d2gsra2: 2gsr A:1-76 [32880]
    Other proteins in same PDB: d2gsra1, d2gsrb1

Details for d2gsra2

PDB Entry: 2gsr (more details), 2.11 Å

PDB Description: structure of porcine class pi glutathione s-transferase

SCOP Domain Sequences for d2gsra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gsra2 c.47.1.5 (A:1-76) Class pi GST {Pig (Sus scrofa)}
ppytityfpvrgrceamrmlladqdqswkeevvtmetwpplkpsclfrqlpkfqdgdltl
yqsnailrhlgrsfgl

SCOP Domain Coordinates for d2gsra2:

Click to download the PDB-style file with coordinates for d2gsra2.
(The format of our PDB-style files is described here.)

Timeline for d2gsra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gsra1