Lineage for d2gsra2 (2gsr A:1-76)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 123181Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
  4. 123182Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 123318Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)
  6. 123330Protein Glutathione S-transferase [52863] (24 species)
  7. 123524Species Pig (Sus scrofa), class pi [52865] (1 PDB entry)
  8. 123525Domain d2gsra2: 2gsr A:1-76 [32880]
    Other proteins in same PDB: d2gsra1, d2gsrb1

Details for d2gsra2

PDB Entry: 2gsr (more details), 2.11 Å

PDB Description: structure of porcine class pi glutathione s-transferase

SCOP Domain Sequences for d2gsra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gsra2 c.47.1.5 (A:1-76) Glutathione S-transferase {Pig (Sus scrofa), class pi}
ppytityfpvrgrceamrmlladqdqswkeevvtmetwpplkpsclfrqlpkfqdgdltl
yqsnailrhlgrsfgl

SCOP Domain Coordinates for d2gsra2:

Click to download the PDB-style file with coordinates for d2gsra2.
(The format of our PDB-style files is described here.)

Timeline for d2gsra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gsra1