SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tpba1 (5tpb A:876-1079)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2043490Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (3 protein domains)
    automatically mapped to Pfam PF07953
  6. 2043528Protein automated matches [229097] (3 species)
    not a true protein
  7. 2043529Species Clostridium botulinum [TaxId:1491] [229098] (7 PDB entries)
  8. 2285498Domain d5tpba1: 5tpb A:876-1079 [328799]
    Other proteins in same PDB: d5tpba2, d5tpba3, d5tpba4, d5tpbb2, d5tpbb3
    automated match to d2vuaa1
    complexed with gal, nga, sia

Details for d5tpba1

PDB Entry: 5tpb (more details), 2.6 Å

PDB Description: binding domain of bont/a complexed with ganglioside variant
PDB Compounds: (A:) Botulinum neurotoxin type A

SCOPe Domain Sequences for d5tpba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tpba1 b.29.1.6 (A:876-1079) automated matches {Clostridium botulinum [TaxId: 1491]}
tsilnlryesnhlidlsryaskinigskvnfdpidknqiqlfnlesskievilknaivyn
smyenfstsfwiripkyfnsislnneytiincmennsgwkvslnygeiiwtlqdtqeikq
rvvfkysqminisdyinrwifvtitnnrlnnskiyingrlidqkpisnlgnihasnnimf
kldgcrdthryiwikyfnlfdkel

SCOPe Domain Coordinates for d5tpba1:

Click to download the PDB-style file with coordinates for d5tpba1.
(The format of our PDB-style files is described here.)

Timeline for d5tpba1:

  • d5tpba1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-19