![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.61.1: PRTase-like [53271] (3 families) ![]() |
![]() | Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 protein domains) |
![]() | Protein automated matches [190074] (13 species) not a true protein |
![]() | Species Plasmodium vivax [TaxId:5855] [328484] (2 PDB entries) |
![]() | Domain d5hhuh_: 5hhu H: [328794] Other proteins in same PDB: d5hhua2, d5hhub2, d5hhuc2, d5hhuf2 automated match to d1cjba_ complexed with mg, ypg |
PDB Entry: 5hhu (more details), 3.05 Å
SCOPe Domain Sequences for d5hhuh_:
Sequence, based on SEQRES records: (download)
>d5hhuh_ c.61.1.1 (H:) automated matches {Plasmodium vivax [TaxId: 5855]} kipnnpgagenalepiyikdddgydidtflipdhyknyitkvlipngvlknrieklafdi kqvyrneefhvicllkgsrgffsallkylnrihnysstespkhlyvehyvrvksycndqs ldrieivsedlsclkdkhvlivediidtgktllkfceylkkfevktiaitclfikrtplw ngfkadfvgfsipdafvvgysldynekfrdldhlclvndegikkfrt
>d5hhuh_ c.61.1.1 (H:) automated matches {Plasmodium vivax [TaxId: 5855]} kipnnpgagenalepiyikdddgydidtflipdhyknyitkvlipngvlknrieklafdi kqvyrneefhvicllkgsrgffsallkylnrihnysstespkhlyvehyvrvksieivse dlsclkdkhvlivediidtgktllkfceylkkfevktiaitclfikrtplwngfkadfvg fsipdafvvgysldynekfrdldhlclvndegikkfrt
Timeline for d5hhuh_: