![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
![]() | Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) ![]() |
![]() | Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 protein domains) |
![]() | Protein automated matches [190079] (9 species) not a true protein |
![]() | Species Stenotrophomonas maltophilia [TaxId:40324] [186946] (7 PDB entries) |
![]() | Domain d5hh6a_: 5hh6 A: [328793] automated match to d2fu9a_ complexed with 60n, so4, zn |
PDB Entry: 5hh6 (more details), 1.8 Å
SCOPe Domain Sequences for d5hh6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hh6a_ d.157.1.1 (A:) automated matches {Stenotrophomonas maltophilia [TaxId: 40324]} evplpqlraytvdaswlqpmaplqiadhtwqigtedltallvqtpdgavlldggmpqmas hlldnmkargvtprdlrlillshahadhagpvaelkrrtgakvaanaesavllarggsdd lhfgdgityppanadrivmdgevitvggivftahfmaghtpgstawtwtdtrngkpvria yadslsapgyqlqgnpryphliedyrrsfatvralpcdvlltphpgasnwdyaagaraga kaltckayadaaeqkfdgqlaketag
Timeline for d5hh6a_: