SCOP 1.57: Domain d1gssb2: 1gss B:1-76

Lineage for d1gssb2 (1gss B:1-76)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.47: Thioredoxin fold [52832] (3 superfamilies)

4. Superfamily c.47.1: Thioredoxin-like [52833] (10 families)

5. Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (3 proteins)

6. Protein Glutathione S-transferase [52863] (24 species)

7. Species Human (Homo sapiens), class pi [TaxId:9606] [52864] (30 PDB entries)

8. Domain d1gssb2: 1gss B:1-76 [32879]
   Other proteins in same PDB: d1gssa1, d1gssb1

Details for d1gssb2

PDB Entry: 1gss, 2.8 Å

PDB Description: three-dimensional structure of class pi glutathione s-transferase from human placenta in complex with s-hexylglutathione at 2.8 angstroms resolution

SCOP Domain Sequences for d1gssb2:

Sequence; same for both SEQRES and ATOM records:

>d1gssb2 c.47.1.5 (B:1-76) Glutathione S-transferase {Human (Homo sapiens), class pi}
ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
tlyqsntilrhlgrtlgl

Timeline for d1gssb2:

• d1gssb2 first appeared (with stable ids) in SCOP 1.55
  
• d1gssb2 appears in SCOP 1.59
  
• d1gssb2 appears in the current release, SCOPe 2.08