SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hf2x_ (5hf2 X:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2136820Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2136821Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2136822Family c.71.1.1: Dihydrofolate reductases [53598] (4 protein domains)
  6. 2136851Protein Dihydrofolate reductase, prokaryotic type [53599] (8 species)
  7. 2136984Species Staphylococcus aureus [TaxId:1280] [188976] (25 PDB entries)
  8. 2285484Domain d5hf2x_: 5hf2 X: [328785]
    automated match to d3sqyx_
    complexed with gol, u75, xnp

Details for d5hf2x_

PDB Entry: 5hf2 (more details), 1.81 Å

PDB Description: staphylococcus aureus dihydrofolate reductase complexed with cyclized alpha-nadph anomer and 3'-(3-(2,4-diamino-6-ethylpyrimidin-5-yl)prop- 2-yn-1-yl)-5'-methoxy-[1,1'-biphenyl]-4-carboxylic acid (ucp1175)
PDB Compounds: (X:) dihydrofolate reductase

SCOPe Domain Sequences for d5hf2x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hf2x_ c.71.1.1 (X:) Dihydrofolate reductase, prokaryotic type {Staphylococcus aureus [TaxId: 1280]}
tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
vltsdtsfnvegvdvihsiediyqlpghvfifggqtlfeemidkvddmyitviegkfrgd
tffppytfedwevassvegkldekntiphtflhlirk

SCOPe Domain Coordinates for d5hf2x_:

Click to download the PDB-style file with coordinates for d5hf2x_.
(The format of our PDB-style files is described here.)

Timeline for d5hf2x_:

  • d5hf2x_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-19