Lineage for d5hjxb2 (5hjx B:139-455)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2088460Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2088461Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 protein domains)
    N-terminal domain is alpha+beta
  6. 2088660Protein automated matches [226984] (9 species)
    not a true protein
  7. 2284490Species Rhodopseudomonas palustris [TaxId:1076] [327791] (7 PDB entries)
  8. 2285483Domain d5hjxb2: 5hjx B:139-455 [328784]
    Other proteins in same PDB: d5hjxa1, d5hjxb1, d5hjxc1, d5hjxd1, d5hjxe1, d5hjxf1
    automated match to d4lf2a2
    complexed with cap, mg; mutant

Details for d5hjxb2

PDB Entry: 5hjx (more details), 1.8 Å

PDB Description: structure function studies of r. palustris rubisco (a47v mutant; cabp- bound)
PDB Compounds: (B:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d5hjxb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hjxb2 c.1.14.1 (B:139-455) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
gpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfanacydfwlggdfikndepqg
nqvfapfkdtvravadamrraqdktgeaklfsfnitaddhyemlargefiletfadnadh
iaflvdgyvagpaavttarrafpkqylhyhraghgavtspqskrgytafvlskmarlqga
sgihtgtmgfgkmegeaadraiaymitedaadgpyfhqewlgmnpttpiisggmnalrmp
gffdnlghsnlimtagggafghvdggaagakslrqaeqcwkqgadpvefakdhrefaraf
esfpqdadklypnwrak

SCOPe Domain Coordinates for d5hjxb2:

Click to download the PDB-style file with coordinates for d5hjxb2.
(The format of our PDB-style files is described here.)

Timeline for d5hjxb2:

  • d5hjxb2 appears in periodic updates to SCOPe 2.06 starting on 2017-01-19