SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5u9pd_ (5u9p D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (226 species)
    not a true protein
  7. 2094600Species Burkholderia cenocepacia [TaxId:216591] [193149] (10 PDB entries)
  8. 2285481Domain d5u9pd_: 5u9p D: [328782]
    Other proteins in same PDB: d5u9pa2, d5u9pb2
    automated match to d3o03a_
    complexed with edo, nap, tla

Details for d5u9pd_

PDB Entry: 5u9p (more details), 1.65 Å

PDB Description: crystal structure of a gluconate 5-dehydrogenase from burkholderia cenocepacia j2315 in complex with nadp and tartrate
PDB Compounds: (D:) Gluconate 5-dehydrogenase

SCOPe Domain Sequences for d5u9pd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u9pd_ c.2.1.0 (D:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
mthaldrfrldgrralitgsgrgigltlarglaeagaaivindrneekaatlarrfrdeg
faadhavfdvaehaqvraaidefearvgaidilvnnagiqrrapldafepddwhalmrvn
ldgvfnvaqavarhmiarghgkiinicsvqselarptiapyaatkgavrmltkgmcadwa
rygiqanglapgyfetelnralvddaafsdwlckrtpagrwgqvdelcgaaiflasaasd
fvngqtlfvdggltsav

SCOPe Domain Coordinates for d5u9pd_:

Click to download the PDB-style file with coordinates for d5u9pd_.
(The format of our PDB-style files is described here.)

Timeline for d5u9pd_:

  • d5u9pd_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-19