![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.46: FMT C-terminal domain-like [50485] (1 superfamily) barrel, open; n*=6, S*=10; greek-key |
![]() | Superfamily b.46.1: FMT C-terminal domain-like [50486] (3 families) ![]() |
![]() | Family b.46.1.0: automated matches [227262] (1 protein) not a true family |
![]() | Protein automated matches [227053] (7 species) not a true protein |
![]() | Species Pseudomonas aeruginosa [TaxId:208964] [328729] (1 PDB entry) |
![]() | Domain d5uaia2: 5uai A:208-313 [328780] Other proteins in same PDB: d5uaia1, d5uaib1, d5uaic1, d5uaid1 automated match to d3r8xa2 complexed with edo |
PDB Entry: 5uai (more details), 2.75 Å
SCOPe Domain Sequences for d5uaia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5uaia2 b.46.1.0 (A:208-313) automated matches {Pseudomonas aeruginosa [TaxId: 208964]} lnkdearldwsrpavelerqvraftpwpvchtsladaplkvlgaslgqgsgapgtileas rdgllvacgegalrltrlqlpggkplafadlynsrreqfaagqvlg
Timeline for d5uaia2: