Lineage for d5uaia2 (5uai A:208-313)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055556Fold b.46: FMT C-terminal domain-like [50485] (1 superfamily)
    barrel, open; n*=6, S*=10; greek-key
  4. 2055557Superfamily b.46.1: FMT C-terminal domain-like [50486] (3 families) (S)
  5. 2055604Family b.46.1.0: automated matches [227262] (1 protein)
    not a true family
  6. 2055605Protein automated matches [227053] (7 species)
    not a true protein
  7. 2285428Species Pseudomonas aeruginosa [TaxId:208964] [328729] (1 PDB entry)
  8. 2285479Domain d5uaia2: 5uai A:208-313 [328780]
    Other proteins in same PDB: d5uaia1, d5uaib1, d5uaic1, d5uaid1
    automated match to d3r8xa2
    complexed with edo

Details for d5uaia2

PDB Entry: 5uai (more details), 2.75 Å

PDB Description: crystal structure of methionyl-trna formyltransferase from pseudomonas aeruginosa
PDB Compounds: (A:) Methionyl-tRNA formyltransferase

SCOPe Domain Sequences for d5uaia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uaia2 b.46.1.0 (A:208-313) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
lnkdearldwsrpavelerqvraftpwpvchtsladaplkvlgaslgqgsgapgtileas
rdgllvacgegalrltrlqlpggkplafadlynsrreqfaagqvlg

SCOPe Domain Coordinates for d5uaia2:

Click to download the PDB-style file with coordinates for d5uaia2.
(The format of our PDB-style files is described here.)

Timeline for d5uaia2:

  • d5uaia2 appears in periodic updates to SCOPe 2.06 starting on 2017-01-19