SCOPe 2.06: Domain d5uaia2: 5uai A:208-313

SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5uaia2 (5uai A:208-313)

Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds)
Fold b.46: FMT C-terminal domain-like [50485] (1 superfamily)
barrel, open; n*=6, S*=10; greek-key
Superfamily b.46.1: FMT C-terminal domain-like [50486] (3 families)
Family b.46.1.0: automated matches [227262] (1 protein)
not a true family
Protein automated matches [227053] (7 species)
not a true protein
Species Pseudomonas aeruginosa [TaxId:208964] [328729] (1 PDB entry)
Domain d5uaia2: 5uai A:208-313 [328780]
Other proteins in same PDB: d5uaia1, d5uaib1, d5uaic1, d5uaid1
automated match to d3r8xa2
complexed with edo

Details for d5uaia2

PDB Entry: 5uai (more details), 2.75 Å

PDB Description: crystal structure of methionyl-trna formyltransferase from pseudomonas aeruginosa

PDB Compounds: (A:) Methionyl-tRNA formyltransferase

SCOPe Domain Sequences for d5uaia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uaia2 b.46.1.0 (A:208-313) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
lnkdearldwsrpavelerqvraftpwpvchtsladaplkvlgaslgqgsgapgtileas
rdgllvacgegalrltrlqlpggkplafadlynsrreqfaagqvlg

SCOPe Domain Coordinates for d5uaia2:

Click to download the PDB-style file with coordinates for d5uaia2.
(The format of our PDB-style files is described here.)

Timeline for d5uaia2: