SCOPe 2.07: Domain d5uaia2: 5uai A:208-313

Lineage for d5uaia2 (5uai A:208-313)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.46: FMT C-terminal domain-like [50485] (1 superfamily)
   barrel, open; n*=6, S*=10; greek-key

4. Superfamily b.46.1: FMT C-terminal domain-like [50486] (3 families)

5. Family b.46.1.0: automated matches [227262] (1 protein)
   not a true family

6. Protein automated matches [227053] (7 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:208964] [328729] (1 PDB entry)

8. Domain d5uaia2: 5uai A:208-313 [328780]
   Other proteins in same PDB: d5uaia1, d5uaib1, d5uaic1, d5uaid1
   automated match to d3r8xa2
   complexed with edo

Details for d5uaia2

PDB Entry: 5uai, 2.75 Å

PDB Description: crystal structure of methionyl-trna formyltransferase from pseudomonas aeruginosa

PDB Compounds: (A:) Methionyl-tRNA formyltransferase

SCOPe Domain Sequences for d5uaia2:

Sequence; same for both SEQRES and ATOM records:

>d5uaia2 b.46.1.0 (A:208-313) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
lnkdearldwsrpavelerqvraftpwpvchtsladaplkvlgaslgqgsgapgtileas
rdgllvacgegalrltrlqlpggkplafadlynsrreqfaagqvlg

Timeline for d5uaia2:

• d5uaia2 first appeared in SCOPe 2.06