SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ketb_ (5ket B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080913Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2081379Family c.1.7.0: automated matches [191491] (1 protein)
    not a true family
  6. 2081380Protein automated matches [190793] (26 species)
    not a true protein
  7. 2285459Species Coptotermes gestroi [TaxId:232242] [328760] (1 PDB entry)
  8. 2285477Domain d5ketb_: 5ket B: [328778]
    automated match to d2fgba_
    complexed with nap

Details for d5ketb_

PDB Entry: 5ket (more details), 2.85 Å

PDB Description: structure of the aldo-keto reductase from coptotermes gestroi
PDB Compounds: (B:) Aldo-keto reductase 1

SCOPe Domain Sequences for d5ketb_:

Sequence, based on SEQRES records: (download)

>d5ketb_ c.1.7.0 (B:) automated matches {Coptotermes gestroi [TaxId: 232242]}
kqlssvtfhngrkmpvvglgtwqsppeevtaaidvalevgyrhidtafmyqneaaigktl
kkwfdsgklkredvfivtklppignraesvekfltkslealqldyvdlylihlpvgfqyk
gddnlwprgeageflidtstdlislwkameaqvdagrtrsvglsnfnsrqiarivksari
rpanlqvelnvyfqqrelvafcralditvcayapigspglanvikargaevpesakfdpl
tdpvvlkiaehhkktpaqvllrhcmqrdivvipkstnagrikenfqvfdfelskaevdel
dsldkraagrrfrmdqykglrehpehpydepy

Sequence, based on observed residues (ATOM records): (download)

>d5ketb_ c.1.7.0 (B:) automated matches {Coptotermes gestroi [TaxId: 232242]}
kqlssvtfhngrkmpvvglgtwqsppeevtaaidvalevgyrhidtafmyqneaaigktl
kkwfdsgklkredvfivtklppignraesvekfltkslealqldyvdlylihlpvgfqyk
gddnlwplidtstdlislwkameaqvdagrtrsvglsnfnsrqiarivksarirpanlqv
elnvyfqqrelvafcralditvcayapigspglanvvpesakfdpltdpvvlkiaehhkk
tpaqvllrhcmqrdivvipkstnagrikenfqvfdfelskaevdeldsldkraagrrfrm
glrehpehpydepy

SCOPe Domain Coordinates for d5ketb_:

Click to download the PDB-style file with coordinates for d5ketb_.
(The format of our PDB-style files is described here.)

Timeline for d5ketb_:

  • d5ketb_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-19