SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5u9da_ (5u9d A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2195690Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 protein domains)
    members organized in the groups and subfamiles specified by the comments
  6. 2198144Protein automated matches [190091] (14 species)
    not a true protein
  7. 2198237Species Human (Homo sapiens) [TaxId:9606] [188447] (577 PDB entries)
  8. 2285476Domain d5u9da_: 5u9d A: [328777]
    automated match to d4z3va_
    complexed with 83p, edo, peg

Details for d5u9da_

PDB Entry: 5u9d (more details), 1.33 Å

PDB Description: discovery of a potent btk inhibitor with a novel binding mode using parallel selections with a dna-encoded chemical library
PDB Compounds: (A:) Tyrosine-protein kinase BTK

SCOPe Domain Sequences for d5u9da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u9da_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
glgygsweidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakv
mmnlsheklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvcea
meyleskqflhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppev
lmyskfssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvyt
imyscwhekaderptfkillsnildvmdees

SCOPe Domain Coordinates for d5u9da_:

Click to download the PDB-style file with coordinates for d5u9da_.
(The format of our PDB-style files is described here.)

Timeline for d5u9da_:

  • d5u9da_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-19