SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ue1a1 (5ue1 A:1-231)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2125386Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2125403Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2125404Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 protein domains)
  6. 2126112Protein automated matches [190142] (19 species)
    not a true protein
  7. 2285470Species Vibrio fischeri [TaxId:312309] [328771] (1 PDB entry)
  8. 2285471Domain d5ue1a1: 5ue1 A:1-231 [328772]
    Other proteins in same PDB: d5ue1a2, d5ue1b2
    automated match to d3dp9c_
    complexed with 9da, ca, cl, edo, trs

Details for d5ue1a1

PDB Entry: 5ue1 (more details), 1.14 Å

PDB Description: crystal structure of 5'-methylthioadenosine/s-adenosylhomocysteine nucleosidase in complex with adenine from vibrio fischeri es114
PDB Compounds: (A:) 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

SCOPe Domain Sequences for d5ue1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ue1a1 c.56.2.1 (A:1-231) automated matches {Vibrio fischeri [TaxId: 312309]}
mkigiigameqevailkdkieglstvtkagctfytgtlngadvvllqsgigkvaaavgtt
lliaehnvdvvlntgsaggfdsslnlgdvvistevrhhdadvtafgyemgqmaqqpaafi
adeklittaeqaltemsdkhavrglictgdvfvctperqefirthfpsviavemeasaia
qtchqfntpfvvvraisdvadkespmsfdeflplaaqsssemvlnmvtllk

SCOPe Domain Coordinates for d5ue1a1:

Click to download the PDB-style file with coordinates for d5ue1a1.
(The format of our PDB-style files is described here.)

Timeline for d5ue1a1:

  • d5ue1a1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-19

View in 3D
Domains from same chain:
(mouse over for more information)
d5ue1a2