SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hk3b_ (5hk3 B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2045654Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2046974Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (4 families) (S)
    contains insert beta-sheet subdomain and C-terminal helix
  5. 2285221Family b.34.6.0: automated matches [328522] (1 protein)
    not a true family
  6. 2285222Protein automated matches [328523] (1 species)
    not a true protein
  7. 2285223Species Mycobacterium tuberculosis [TaxId:83332] [328524] (3 PDB entries)
  8. 2285465Domain d5hk3b_: 5hk3 B: [328766]
    automated match to d4of1a_
    protein/DNA complex; mutant

Details for d5hk3b_

PDB Entry: 5hk3 (more details), 1.56 Å

PDB Description: crystal structure of m. tuberculosis mazf-mt3 t52d-f62d mutant in complex with dna
PDB Compounds: (B:) Endoribonuclease MazF6

SCOPe Domain Sequences for d5hk3b_:

Sequence, based on SEQRES records: (download)

>d5hk3b_ b.34.6.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
visraeiywadlgppsgsqpakrrpvlviqsdpynasrlatviaavitsndalaampgnv
dlpatttrlprdsvvnvtaivtlnktdltdrvgevpaslmhevdrglrrvldl

Sequence, based on observed residues (ATOM records): (download)

>d5hk3b_ b.34.6.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
visraeiywadlrrpvlviqsdpynasrlatviaavitsndalaampgnvdlpatttrlp
rdsvvnvtaivtlnktdltdrvgevpaslmhevdrglrrvldl

SCOPe Domain Coordinates for d5hk3b_:

Click to download the PDB-style file with coordinates for d5hk3b_.
(The format of our PDB-style files is described here.)

Timeline for d5hk3b_:

  • d5hk3b_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-19

View in 3D
Domains from other chains:
(mouse over for more information)
d5hk3a_