Lineage for d5tpbb2 (5tpb B:1080-1296)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2384842Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2385622Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2385683Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (3 protein domains)
    overall fold is very similar to that of the STI family
    automatically mapped to Pfam PF07951
  6. 2385726Protein automated matches [229100] (5 species)
    not a true protein
  7. 2385727Species Clostridium botulinum [TaxId:1491] [229101] (13 PDB entries)
  8. 2385739Domain d5tpbb2: 5tpb B:1080-1296 [328764]
    Other proteins in same PDB: d5tpba1, d5tpba3, d5tpba4, d5tpbb1, d5tpbb3
    automated match to d2vuaa2
    complexed with gal, nga, sia

Details for d5tpbb2

PDB Entry: 5tpb (more details), 2.6 Å

PDB Description: binding domain of bont/a complexed with ganglioside variant
PDB Compounds: (B:) Botulinum neurotoxin type A

SCOPe Domain Sequences for d5tpbb2:

Sequence, based on SEQRES records: (download)

>d5tpbb2 b.42.4.2 (B:1080-1296) automated matches {Clostridium botulinum [TaxId: 1491]}
nekeikdlydnqsnsgilkdfwgdylqydkpyymlnlydpnkyvdvnnvgirgymylkgp
rgsvmttniylnsslyrgtkfiikkyasgnkdnivrnndrvyinvvvknkeyrlatnasq
agvekilsaleipdvgnlsqvvvmkskndqgitnkckmnlqdnngndigfigfhqfnnia
klvasnwynrqierssrtlgcswefipvddgwgerpl

Sequence, based on observed residues (ATOM records): (download)

>d5tpbb2 b.42.4.2 (B:1080-1296) automated matches {Clostridium botulinum [TaxId: 1491]}
nekeikdlydnqsnsgilkdfwgdylqydkpyymlnlydpnkyvdvnnvgirgymylkgp
rgsvmttniylnsslyrgtkfiikkyasgnkdnivrnndrvyinvvvknkeyrlatnasq
agvekilsaleipdvgnlsqvvvmksckmnlqdnngndigfigfhqfnniaklvasnwyn
rqrtlgcswefipvddgwgerpl

SCOPe Domain Coordinates for d5tpbb2:

Click to download the PDB-style file with coordinates for d5tpbb2.
(The format of our PDB-style files is described here.)

Timeline for d5tpbb2: