SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tpbb2 (5tpb B:1080-1296)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2053108Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2053846Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2053907Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (3 protein domains)
    overall fold is very similar to that of the STI family
    automatically mapped to Pfam PF07951
  6. 2053945Protein automated matches [229100] (3 species)
    not a true protein
  7. 2053946Species Clostridium botulinum [TaxId:1491] [229101] (9 PDB entries)
  8. 2285463Domain d5tpbb2: 5tpb B:1080-1296 [328764]
    Other proteins in same PDB: d5tpba1, d5tpba3, d5tpba4, d5tpbb1, d5tpbb3
    automated match to d2vuaa2
    complexed with gal, nga, sia

Details for d5tpbb2

PDB Entry: 5tpb (more details), 2.6 Å

PDB Description: binding domain of bont/a complexed with ganglioside variant
PDB Compounds: (B:) Botulinum neurotoxin type A

SCOPe Domain Sequences for d5tpbb2:

Sequence, based on SEQRES records: (download)

>d5tpbb2 b.42.4.2 (B:1080-1296) automated matches {Clostridium botulinum [TaxId: 1491]}
nekeikdlydnqsnsgilkdfwgdylqydkpyymlnlydpnkyvdvnnvgirgymylkgp
rgsvmttniylnsslyrgtkfiikkyasgnkdnivrnndrvyinvvvknkeyrlatnasq
agvekilsaleipdvgnlsqvvvmkskndqgitnkckmnlqdnngndigfigfhqfnnia
klvasnwynrqierssrtlgcswefipvddgwgerpl

Sequence, based on observed residues (ATOM records): (download)

>d5tpbb2 b.42.4.2 (B:1080-1296) automated matches {Clostridium botulinum [TaxId: 1491]}
nekeikdlydnqsnsgilkdfwgdylqydkpyymlnlydpnkyvdvnnvgirgymylkgp
rgsvmttniylnsslyrgtkfiikkyasgnkdnivrnndrvyinvvvknkeyrlatnasq
agvekilsaleipdvgnlsqvvvmksckmnlqdnngndigfigfhqfnniaklvasnwyn
rqrtlgcswefipvddgwgerpl

SCOPe Domain Coordinates for d5tpbb2:

Click to download the PDB-style file with coordinates for d5tpbb2.
(The format of our PDB-style files is described here.)

Timeline for d5tpbb2:

  • d5tpbb2 appears in periodic updates to SCOPe 2.06 starting on 2017-01-19