Class b: All beta proteins [48724] (180 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.4: STI-like [50386] (3 families) |
Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (3 proteins) overall fold is very similar to that of the STI family automatically mapped to Pfam PF07951 |
Protein automated matches [229100] (6 species) not a true protein |
Species Clostridium botulinum [TaxId:1491] [229101] (14 PDB entries) |
Domain d5tpbb2: 5tpb B:1080-1296 [328764] Other proteins in same PDB: d5tpba1, d5tpba3, d5tpba4, d5tpbb1, d5tpbb3 automated match to d2vuaa2 complexed with sia |
PDB Entry: 5tpb (more details), 2.6 Å
SCOPe Domain Sequences for d5tpbb2:
Sequence, based on SEQRES records: (download)
>d5tpbb2 b.42.4.2 (B:1080-1296) automated matches {Clostridium botulinum [TaxId: 1491]} nekeikdlydnqsnsgilkdfwgdylqydkpyymlnlydpnkyvdvnnvgirgymylkgp rgsvmttniylnsslyrgtkfiikkyasgnkdnivrnndrvyinvvvknkeyrlatnasq agvekilsaleipdvgnlsqvvvmkskndqgitnkckmnlqdnngndigfigfhqfnnia klvasnwynrqierssrtlgcswefipvddgwgerpl
>d5tpbb2 b.42.4.2 (B:1080-1296) automated matches {Clostridium botulinum [TaxId: 1491]} nekeikdlydnqsnsgilkdfwgdylqydkpyymlnlydpnkyvdvnnvgirgymylkgp rgsvmttniylnsslyrgtkfiikkyasgnkdnivrnndrvyinvvvknkeyrlatnasq agvekilsaleipdvgnlsqvvvmksckmnlqdnngndigfigfhqfnniaklvasnwyn rqrtlgcswefipvddgwgerpl
Timeline for d5tpbb2:
View in 3D Domains from other chains: (mouse over for more information) d5tpba1, d5tpba2, d5tpba3, d5tpba4 |