SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5u8jb1 (5u8j B:1-84)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983660Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1983661Protein automated matches [190154] (64 species)
    not a true protein
  7. 2285421Species Enterobacter cloacae [TaxId:550] [328722] (1 PDB entry)
  8. 2285457Domain d5u8jb1: 5u8j B:1-84 [328758]
    automated match to d3bz6a1
    complexed with cl

Details for d5u8jb1

PDB Entry: 5u8j (more details), 2.52 Å

PDB Description: crystal structure of a protein of unknown function ecl_02571 involved in membrane biogenesis from enterobacter cloacae
PDB Compounds: (B:) UPF0502 protein BFJ73_07745

SCOPe Domain Sequences for d5u8jb1:

Sequence, based on SEQRES records: (download)

>d5u8jb1 a.4.5.0 (B:1-84) automated matches {Enterobacter cloacae [TaxId: 550]}
mkyqlsatearvigcllekqvttpeqyplsvnavtmacnqktnrepvmnlgehevqdild
elvkrhylrtvsgfgnrvtkyeqr

Sequence, based on observed residues (ATOM records): (download)

>d5u8jb1 a.4.5.0 (B:1-84) automated matches {Enterobacter cloacae [TaxId: 550]}
mkyqlsatearvigcllekqvttpeqyplsvnavtmacnqktnrepvmnlgehevqdild
elvkrhylrtvsgrvtkyeqr

SCOPe Domain Coordinates for d5u8jb1:

Click to download the PDB-style file with coordinates for d5u8jb1.
(The format of our PDB-style files is described here.)

Timeline for d5u8jb1:

  • d5u8jb1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-19