Lineage for d5ufha_ (5ufh A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143708Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2143709Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2143989Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 2143990Protein automated matches [190646] (70 species)
    not a true protein
  7. 2285453Species Bifidobacterium animalis [TaxId:442563] [328754] (1 PDB entry)
  8. 2285454Domain d5ufha_: 5ufh A: [328755]
    automated match to d4kmra_
    complexed with gol, no3

Details for d5ufha_

PDB Entry: 5ufh (more details), 1.45 Å

PDB Description: the crystal structure of a laci-type transcription regulator from bifidobacterium animalis subsp. lactis dsm 10140
PDB Compounds: (A:) LacI-type transcriptional regulator

SCOPe Domain Sequences for d5ufha_:

Sequence, based on SEQRES records: (download)

>d5ufha_ c.93.1.0 (A:) automated matches {Bifidobacterium animalis [TaxId: 442563]}
gllglaifdfsqpfasyladqiivcarehhygviintygqnehglaramrqannlaadgw
ivfadhamgqhskmldqsyplvltgdwdaygkvdqvtmpnveamryttnrlldsgyrsia
lfgadgslgarhyrqategtqelrvqgymqayeehgiearmdmlfsgglltsdsgvratn
lmmdqgvrpdaiiclndamalgalhqlqvrgirvpddvqvvgfdnvpeatyanpslttid
phidsyarhavdmlieriqgydgakrvytsdftlversstsl

Sequence, based on observed residues (ATOM records): (download)

>d5ufha_ c.93.1.0 (A:) automated matches {Bifidobacterium animalis [TaxId: 442563]}
gllglaifdfsqpfasyladqiivcarehhygviintygqnehglaramrqannlaadgw
ivfadhamgqkmldqsyplvltgdwdaygkvdqvtmpnveamryttnrlldsgyrsialf
gadgslgarhyrqategtqelrvqgymqayeehgiearmdmlfsgglltsdsgvratnlm
mdqgvrpdaiiclndamalgalhqlqvrgirvpddvqvvgfdnvpeatyanpslttidph
idsyarhavdmlieriqgydgakrvytsdftlversstsl

SCOPe Domain Coordinates for d5ufha_:

Click to download the PDB-style file with coordinates for d5ufha_.
(The format of our PDB-style files is described here.)

Timeline for d5ufha_:

  • d5ufha_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-19