SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ufha_ (5ufh A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143708Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2143709Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2143989Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 2143990Protein automated matches [190646] (69 species)
    not a true protein
  7. 2285453Species Bifidobacterium animalis [TaxId:442563] [328754] (1 PDB entry)
  8. 2285454Domain d5ufha_: 5ufh A: [328755]
    automated match to d4kmra_
    complexed with gol, no3

Details for d5ufha_

PDB Entry: 5ufh (more details), 1.45 Å

PDB Description: the crystal structure of a laci-type transcription regulator from bifidobacterium animalis subsp. lactis dsm 10140
PDB Compounds: (A:) LacI-type transcriptional regulator

SCOPe Domain Sequences for d5ufha_:

Sequence, based on SEQRES records: (download)

>d5ufha_ c.93.1.0 (A:) automated matches {Bifidobacterium animalis [TaxId: 442563]}
gllglaifdfsqpfasyladqiivcarehhygviintygqnehglaramrqannlaadgw
ivfadhamgqhskmldqsyplvltgdwdaygkvdqvtmpnveamryttnrlldsgyrsia
lfgadgslgarhyrqategtqelrvqgymqayeehgiearmdmlfsgglltsdsgvratn
lmmdqgvrpdaiiclndamalgalhqlqvrgirvpddvqvvgfdnvpeatyanpslttid
phidsyarhavdmlieriqgydgakrvytsdftlversstsl

Sequence, based on observed residues (ATOM records): (download)

>d5ufha_ c.93.1.0 (A:) automated matches {Bifidobacterium animalis [TaxId: 442563]}
gllglaifdfsqpfasyladqiivcarehhygviintygqnehglaramrqannlaadgw
ivfadhamgqkmldqsyplvltgdwdaygkvdqvtmpnveamryttnrlldsgyrsialf
gadgslgarhyrqategtqelrvqgymqayeehgiearmdmlfsgglltsdsgvratnlm
mdqgvrpdaiiclndamalgalhqlqvrgirvpddvqvvgfdnvpeatyanpslttidph
idsyarhavdmlieriqgydgakrvytsdftlversstsl

SCOPe Domain Coordinates for d5ufha_:

Click to download the PDB-style file with coordinates for d5ufha_.
(The format of our PDB-style files is described here.)

Timeline for d5ufha_:

  • d5ufha_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-19