Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (239 species) not a true protein |
Species Burkholderia cenocepacia [TaxId:216591] [193149] (10 PDB entries) |
Domain d5u9pb1: 5u9p B:1-257 [328749] Other proteins in same PDB: d5u9pa2, d5u9pb2 automated match to d3o03a_ complexed with edo, nap, tla |
PDB Entry: 5u9p (more details), 1.65 Å
SCOPe Domain Sequences for d5u9pb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5u9pb1 c.2.1.0 (B:1-257) automated matches {Burkholderia cenocepacia [TaxId: 216591]} mthaldrfrldgrralitgsgrgigltlarglaeagaaivindrneekaatlarrfrdeg faadhavfdvaehaqvraaidefearvgaidilvnnagiqrrapldafepddwhalmrvn ldgvfnvaqavarhmiarghgkiinicsvqselarptiapyaatkgavrmltkgmcadwa rygiqanglapgyfetelnralvddaafsdwlckrtpagrwgqvdelcgaaiflasaasd fvngqtlfvdggltsav
Timeline for d5u9pb1:
View in 3D Domains from other chains: (mouse over for more information) d5u9pa1, d5u9pa2, d5u9pc_, d5u9pd_ |