SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ufaa2 (5ufa A:107-259)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105127Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2105128Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2105290Family c.25.1.0: automated matches [227163] (1 protein)
    not a true family
  6. 2105291Protein automated matches [226871] (18 species)
    not a true protein
  7. 2285444Species Neisseria gonorrhoeae [TaxId:521006] [328745] (1 PDB entry)
  8. 2285447Domain d5ufaa2: 5ufa A:107-259 [328748]
    Other proteins in same PDB: d5ufaa1, d5ufab1, d5ufac1
    automated match to d3fpka2
    complexed with fad, nap

Details for d5ufaa2

PDB Entry: 5ufa (more details), 2.5 Å

PDB Description: crystal structure of a ferredoxin nadp+ reductase from neisseria gonorrhoeae with bound fad and nadp
PDB Compounds: (A:) Oxidoreductase

SCOPe Domain Sequences for d5ufaa2:

Sequence, based on SEQRES records: (download)

>d5ufaa2 c.25.1.0 (A:107-259) automated matches {Neisseria gonorrhoeae [TaxId: 521006]}
erfpdgkdlvmlctgsgiapflsileqpeirqrfdtvnlihsvsfpeelifndrlaalse
hplvgeyghsfrfvpvttraanpsglsgkripellknnsieqalhtkltpestrfmicgn
pemvkdtfqtlldmgyamhrnripgqimmengf

Sequence, based on observed residues (ATOM records): (download)

>d5ufaa2 c.25.1.0 (A:107-259) automated matches {Neisseria gonorrhoeae [TaxId: 521006]}
erfpdgkdlvmlctgsgiapflsileqpeirqrfdtvnlihsvsfpeelifndrlaalse
hsfrfvpvttraanpsglsgkripellknnsieqalhtkltpestrfmicgnpemvkdtf
qtlldmgyamhrnripgqimmengf

SCOPe Domain Coordinates for d5ufaa2:

Click to download the PDB-style file with coordinates for d5ufaa2.
(The format of our PDB-style files is described here.)

Timeline for d5ufaa2:

  • d5ufaa2 appears in periodic updates to SCOPe 2.06 starting on 2017-01-19