SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ufaa1 (5ufa A:6-106)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2054165Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2054655Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2054836Family b.43.4.0: automated matches [227162] (1 protein)
    not a true family
  6. 2054837Protein automated matches [226870] (20 species)
    not a true protein
  7. 2285442Species Neisseria gonorrhoeae [TaxId:521006] [328743] (1 PDB entry)
  8. 2285446Domain d5ufaa1: 5ufa A:6-106 [328747]
    Other proteins in same PDB: d5ufaa2, d5ufab2, d5ufac2
    automated match to d3fpka1
    complexed with fad, nap

Details for d5ufaa1

PDB Entry: 5ufa (more details), 2.5 Å

PDB Description: crystal structure of a ferredoxin nadp+ reductase from neisseria gonorrhoeae with bound fad and nadp
PDB Compounds: (A:) Oxidoreductase

SCOPe Domain Sequences for d5ufaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ufaa1 b.43.4.0 (A:6-106) automated matches {Neisseria gonorrhoeae [TaxId: 521006]}
eakfteekilwvkhhtpklitfaisrpesyrfkagqfsrlgfyegkgfiwraysvvsaey
adtleyfavliqdgpmsalfakmqqgdtilldknatgfllp

SCOPe Domain Coordinates for d5ufaa1:

Click to download the PDB-style file with coordinates for d5ufaa1.
(The format of our PDB-style files is described here.)

Timeline for d5ufaa1:

  • d5ufaa1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-19

2285446
d5ufaa1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d5ufaa2