Lineage for d5ufaa1 (5ufa A:6-106)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2385975Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2386485Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2386687Family b.43.4.0: automated matches [227162] (1 protein)
    not a true family
  6. 2386688Protein automated matches [226870] (20 species)
    not a true protein
  7. 2386770Species Neisseria gonorrhoeae [TaxId:521006] [328743] (1 PDB entry)
  8. 2386771Domain d5ufaa1: 5ufa A:6-106 [328747]
    Other proteins in same PDB: d5ufaa2, d5ufab2, d5ufac2
    automated match to d3fpka1
    complexed with fad, nap

Details for d5ufaa1

PDB Entry: 5ufa (more details), 2.5 Å

PDB Description: crystal structure of a ferredoxin nadp+ reductase from neisseria gonorrhoeae with bound fad and nadp
PDB Compounds: (A:) Oxidoreductase

SCOPe Domain Sequences for d5ufaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ufaa1 b.43.4.0 (A:6-106) automated matches {Neisseria gonorrhoeae [TaxId: 521006]}
eakfteekilwvkhhtpklitfaisrpesyrfkagqfsrlgfyegkgfiwraysvvsaey
adtleyfavliqdgpmsalfakmqqgdtilldknatgfllp

SCOPe Domain Coordinates for d5ufaa1:

Click to download the PDB-style file with coordinates for d5ufaa1.
(The format of our PDB-style files is described here.)

Timeline for d5ufaa1: