![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) ![]() |
![]() | Family b.43.4.0: automated matches [227162] (1 protein) not a true family |
![]() | Protein automated matches [226870] (20 species) not a true protein |
![]() | Species Neisseria gonorrhoeae [TaxId:521006] [328743] (1 PDB entry) |
![]() | Domain d5ufaa1: 5ufa A:6-106 [328747] Other proteins in same PDB: d5ufaa2, d5ufab2, d5ufac2 automated match to d3fpka1 complexed with fad, nap |
PDB Entry: 5ufa (more details), 2.5 Å
SCOPe Domain Sequences for d5ufaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ufaa1 b.43.4.0 (A:6-106) automated matches {Neisseria gonorrhoeae [TaxId: 521006]} eakfteekilwvkhhtpklitfaisrpesyrfkagqfsrlgfyegkgfiwraysvvsaey adtleyfavliqdgpmsalfakmqqgdtilldknatgfllp
Timeline for d5ufaa1:
![]() Domains from other chains: (mouse over for more information) d5ufab1, d5ufab2, d5ufac1, d5ufac2 |