SCOPe 2.07: Domain d5ufaa1: 5ufa A:6-106

Lineage for d5ufaa1 (5ufa A:6-106)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.0: automated matches [227162] (1 protein)
   not a true family

6. Protein automated matches [226870] (20 species)
   not a true protein

7. Species Neisseria gonorrhoeae [TaxId:521006] [328743] (1 PDB entry)

8. Domain d5ufaa1: 5ufa A:6-106 [328747]
   Other proteins in same PDB: d5ufaa2, d5ufab2, d5ufac2
   automated match to d3fpka1
   complexed with fad, nap

Details for d5ufaa1

PDB Entry: 5ufa, 2.5 Å

PDB Description: crystal structure of a ferredoxin nadp+ reductase from neisseria gonorrhoeae with bound fad and nadp

PDB Compounds: (A:) Oxidoreductase

SCOPe Domain Sequences for d5ufaa1:

Sequence; same for both SEQRES and ATOM records:

>d5ufaa1 b.43.4.0 (A:6-106) automated matches {Neisseria gonorrhoeae [TaxId: 521006]}
eakfteekilwvkhhtpklitfaisrpesyrfkagqfsrlgfyegkgfiwraysvvsaey
adtleyfavliqdgpmsalfakmqqgdtilldknatgfllp

Timeline for d5ufaa1:

• d5ufaa1 first appeared in SCOPe 2.06