Lineage for d5ufab2 (5ufa B:107-259)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2859730Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2859731Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2859901Family c.25.1.0: automated matches [227163] (1 protein)
    not a true family
  6. 2859902Protein automated matches [226871] (19 species)
    not a true protein
  7. 2859969Species Neisseria gonorrhoeae [TaxId:521006] [328745] (1 PDB entry)
  8. 2859971Domain d5ufab2: 5ufa B:107-259 [328746]
    Other proteins in same PDB: d5ufaa1, d5ufab1, d5ufac1
    automated match to d3fpka2
    complexed with fad, nap

Details for d5ufab2

PDB Entry: 5ufa (more details), 2.5 Å

PDB Description: crystal structure of a ferredoxin nadp+ reductase from neisseria gonorrhoeae with bound fad and nadp
PDB Compounds: (B:) Oxidoreductase

SCOPe Domain Sequences for d5ufab2:

Sequence, based on SEQRES records: (download)

>d5ufab2 c.25.1.0 (B:107-259) automated matches {Neisseria gonorrhoeae [TaxId: 521006]}
erfpdgkdlvmlctgsgiapflsileqpeirqrfdtvnlihsvsfpeelifndrlaalse
hplvgeyghsfrfvpvttraanpsglsgkripellknnsieqalhtkltpestrfmicgn
pemvkdtfqtlldmgyamhrnripgqimmengf

Sequence, based on observed residues (ATOM records): (download)

>d5ufab2 c.25.1.0 (B:107-259) automated matches {Neisseria gonorrhoeae [TaxId: 521006]}
erfpdgkdlvmlctgsgiapflsileqpeirqrfdtvnlihsvsfpeelifndrlaalse
hsfrfvpvttraanpsglsgkripellknnsieqalhtkltpestrfmicgnpemvkdtf
qtlldmgyamhrnripgqimmengf

SCOPe Domain Coordinates for d5ufab2:

Click to download the PDB-style file with coordinates for d5ufab2.
(The format of our PDB-style files is described here.)

Timeline for d5ufab2: