SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5t6ua_ (5t6u A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2154577Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2154578Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2154579Family d.3.1.1: Papain-like [54002] (26 protein domains)
  6. 2154605Protein (Pro)cathepsin K [54028] (3 species)
  7. 2285440Species Mus musculus [TaxId:10090] [328741] (1 PDB entry)
  8. 2285441Domain d5t6ua_: 5t6u A: [328742]
    automated match to d2f7da1
    complexed with nag, so4

Details for d5t6ua_

PDB Entry: 5t6u (more details), 2.9 Å

PDB Description: crystal structure of mouse cathepsin k at 2.9 angstroms resolution.
PDB Compounds: (A:) cathepsin k

SCOPe Domain Sequences for d5t6ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t6ua_ d.3.1.1 (A:) (Pro)cathepsin K {Mus musculus [TaxId: 10090]}
vpdsidyrkkgyvtpvknqgqcgscwafssagalegqlkkktgkllalspqnlvdcvten
ygcgggymttafqyvqqnggidsedaypyvgqdescmynatakaakcrgyreipvgneka
lkravarvgpisvsidaslasfqfysrgvyydencdrdnvnhavlvvgygtqkgskhwii
knswgeswgnkgyallarnknnacgitnmasfpkm

SCOPe Domain Coordinates for d5t6ua_:

Click to download the PDB-style file with coordinates for d5t6ua_.
(The format of our PDB-style files is described here.)

Timeline for d5t6ua_:

  • d5t6ua_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-19