SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5uaic1 (5uai C:3-207)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129158Fold c.65: Formyltransferase [53327] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest
  4. 2129159Superfamily c.65.1: Formyltransferase [53328] (2 families) (S)
  5. 2129260Family c.65.1.0: automated matches [191608] (1 protein)
    not a true family
  6. 2129261Protein automated matches [191110] (11 species)
    not a true protein
  7. 2285426Species Pseudomonas aeruginosa [TaxId:208964] [328727] (1 PDB entry)
  8. 2285437Domain d5uaic1: 5uai C:3-207 [328738]
    Other proteins in same PDB: d5uaia2, d5uaib2, d5uaic2, d5uaid2
    automated match to d3r8xa1
    complexed with edo

Details for d5uaic1

PDB Entry: 5uai (more details), 2.75 Å

PDB Description: crystal structure of methionyl-trna formyltransferase from pseudomonas aeruginosa
PDB Compounds: (C:) Methionyl-tRNA formyltransferase

SCOPe Domain Sequences for d5uaic1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uaic1 c.65.1.0 (C:3-207) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
qalrivfagtpefaaehlkalldtphrivavytqpdrpagrgqklmpsavkslalehglp
vmqpqslrnaeaqaelaalradlmvvvayglilpqavldiprlgcinshasllprwrgaa
piqraveagdaesgvtvmqmeagldtgpmllkvstpisaadtggslhdrlaalgpkavie
aiaglaagtlhgeiqddalatyahk

SCOPe Domain Coordinates for d5uaic1:

Click to download the PDB-style file with coordinates for d5uaic1.
(The format of our PDB-style files is described here.)

Timeline for d5uaic1:

  • d5uaic1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-19