SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ucca_ (5ucc A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007623Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) (S)
  5. 2007726Family a.118.9.0: automated matches [191620] (1 protein)
    not a true family
  6. 2007727Protein automated matches [191137] (5 species)
    not a true protein
  7. 2285435Species Candida albicans [TaxId:237561] [328736] (1 PDB entry)
  8. 2285436Domain d5ucca_: 5ucc A: [328737]
    automated match to d1h0aa_
    complexed with cit, cl

Details for d5ucca_

PDB Entry: 5ucc (more details), 1.83 Å

PDB Description: crystal structure of the enth domain of ent2 from candida albicans
PDB Compounds: (A:) Potential epsin-like clathrin-binding protein

SCOPe Domain Sequences for d5ucca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ucca_ a.118.9.0 (A:) automated matches {Candida albicans [TaxId: 237561]}
yssaqrvvrnatsndptgpttfdmeeissftyqsqtefmevmdmldrrlndkgknwrhva
ksltvldylvrygsdkcvlwakdnlyiiktlrefvhfdetnndqgaiirvkakelvsllr
dderlkqeranakkn

SCOPe Domain Coordinates for d5ucca_:

Click to download the PDB-style file with coordinates for d5ucca_.
(The format of our PDB-style files is described here.)

Timeline for d5ucca_:

  • d5ucca_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-19