SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hhub1 (5hhu B:2-228)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2128255Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2128256Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2128257Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 protein domains)
  6. 2128615Protein automated matches [190074] (12 species)
    not a true protein
  7. 2285183Species Plasmodium vivax [TaxId:5855] [328484] (1 PDB entry)
  8. 2285431Domain d5hhub1: 5hhu B:2-228 [328732]
    Other proteins in same PDB: d5hhua2, d5hhub2, d5hhuc2, d5hhuf2
    automated match to d1cjba_
    complexed with mg, ypg

Details for d5hhub1

PDB Entry: 5hhu (more details), 3.05 Å

PDB Description: plasmodium vivax hypoxanthine-guanine phosphoribosyltransferase in complex with [3r,4r]-4-guanin-9-yl-3-((s)-2-hydroxy-2- phosphonoethyl)oxy-1-n-(phosphonopropionyl)pyrrolidine
PDB Compounds: (B:) hypoxanthine-guanine-xanthine phosphoribosyltransferase

SCOPe Domain Sequences for d5hhub1:

Sequence, based on SEQRES records: (download)

>d5hhub1 c.61.1.1 (B:2-228) automated matches {Plasmodium vivax [TaxId: 5855]}
kipnnpgagenalepiyikdddgydidtflipdhyknyitkvlipngvlknrieklafdi
kqvyrneefhvicllkgsrgffsallkylnrihnysstespkhlyvehyvrvksycndqs
ldrieivsedlsclkdkhvlivediidtgktllkfceylkkfevktiaitclfikrtplw
ngfkadfvgfsipdafvvgysldynekfrdldhlclvndegikkfrt

Sequence, based on observed residues (ATOM records): (download)

>d5hhub1 c.61.1.1 (B:2-228) automated matches {Plasmodium vivax [TaxId: 5855]}
kipnnpgagenalepiyikdddgydidtflipdhyknyitkvlipngvlknrieklafdi
kqvyrneefhvicllkgsrgffsallkylnrihnysstespkhlyvehyvrvkieivsed
lsclkdkhvlivediidtgktllkfceylkkfevktiaitclfikrtplwngfkadfvgf
sipdafvvgysldynekfrdldhlclvndegikkfrt

SCOPe Domain Coordinates for d5hhub1:

Click to download the PDB-style file with coordinates for d5hhub1.
(The format of our PDB-style files is described here.)

Timeline for d5hhub1:

  • d5hhub1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-19