SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5m56a_ (5m56 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2195690Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 protein domains)
    members organized in the groups and subfamiles specified by the comments
  6. 2198144Protein automated matches [190091] (14 species)
    not a true protein
  7. 2198237Species Human (Homo sapiens) [TaxId:9606] [188447] (577 PDB entries)
  8. 2285424Domain d5m56a_: 5m56 A: [328725]
    automated match to d4md7h_
    complexed with 7fc, cl, gol

Details for d5m56a_

PDB Entry: 5m56 (more details), 2.24 Å

PDB Description: monoclinic complex structure of human protein kinase ck2 catalytic subunit (isoform ck2alpha') with the inhibitor 4'-carboxy-6,8-chloro- flavonol (flc21)
PDB Compounds: (A:) Casein kinase II subunit alpha'

SCOPe Domain Sequences for d5m56a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m56a_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pgpaagsrarvyaevnslrsreywdyeahvpswgnqdgyqlvrklgrgkysevfeainit
nnervvvkilkpvkkkkikrevkilenlrggtniiklidtvkdpvsktpalvfeyinntd
fkqlyqiltdfdirfymyellkaldychskgimhrdvkphnvmidhqqkklrlidwglae
fyhpaqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrrepffhgqdnyd
qlvriakvlgteelygylkkyhidldphfndilgqhsrkrwenfihsenrhlvspealdl
ldkllrydhqqrltakeamehpyfypvvkeq

SCOPe Domain Coordinates for d5m56a_:

Click to download the PDB-style file with coordinates for d5m56a_.
(The format of our PDB-style files is described here.)

Timeline for d5m56a_:

  • d5m56a_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-19