SCOPe 2.06: Domain d5u8ja1: 5u8j A:1-84

Lineage for d5u8ja1 (5u8j A:1-84)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (68 species)
   not a true protein

7. Species Enterobacter cloacae [TaxId:550] [328722] (1 PDB entry)

8. Domain d5u8ja1: 5u8j A:1-84 [328723]
   automated match to d3bz6a1
   complexed with cl

Details for d5u8ja1

PDB Entry: 5u8j, 2.52 Å

PDB Description: crystal structure of a protein of unknown function ecl_02571 involved in membrane biogenesis from enterobacter cloacae

PDB Compounds: (A:) UPF0502 protein BFJ73_07745

SCOPe Domain Sequences for d5u8ja1:

Sequence; same for both SEQRES and ATOM records:

>d5u8ja1 a.4.5.0 (A:1-84) automated matches {Enterobacter cloacae [TaxId: 550]}
mkyqlsatearvigcllekqvttpeqyplsvnavtmacnqktnrepvmnlgehevqdild
elvkrhylrtvsgfgnrvtkyeqr

Timeline for d5u8ja1:

• d5u8ja1 is new in SCOPe 2.06-stable
  
• d5u8ja1 appears in SCOPe 2.07
  
• d5u8ja1 appears in the current release, SCOPe 2.08