SCOP 1.61: Domain d1eohe2: 1eoh E:1-76

Lineage for d1eohe2 (1eoh E:1-76)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)

4. Superfamily c.47.1: Thioredoxin-like [52833] (12 families)

5. Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)

6. Protein Glutathione S-transferase [52863] (27 species)

7. Species Human (Homo sapiens), class pi [TaxId:9606] [52864] (33 PDB entries)

8. Domain d1eohe2: 1eoh E:1-76 [32872]
   Other proteins in same PDB: d1eoha1, d1eohb1, d1eohc1, d1eohd1, d1eohe1, d1eohf1, d1eohg1, d1eohh1

Details for d1eohe2

PDB Entry: 1eoh, 2.5 Å

PDB Description: glutathione transferase p1-1

SCOP Domain Sequences for d1eohe2:

Sequence; same for both SEQRES and ATOM records:

>d1eohe2 c.47.1.5 (E:1-76) Glutathione S-transferase {Human (Homo sapiens), class pi}
ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
tlyqsntilrhlgrtl

Timeline for d1eohe2:

• d1eohe2 first appeared (with stable ids) in SCOP 1.55
  
• d1eohe2 appears in SCOP 1.59
  
• d1eohe2 appears in SCOP 1.63
  
• d1eohe2 appears in the current release, SCOPe 2.08