SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tpca1 (5tpc A:876-1079)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2043490Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (3 protein domains)
    automatically mapped to Pfam PF07953
  6. 2043528Protein automated matches [229097] (3 species)
    not a true protein
  7. 2043529Species Clostridium botulinum [TaxId:1491] [229098] (7 PDB entries)
  8. 2285417Domain d5tpca1: 5tpc A:876-1079 [328718]
    Other proteins in same PDB: d5tpca2, d5tpca3, d5tpca4
    automated match to d2vuaa1
    complexed with gal, nga, sia

Details for d5tpca1

PDB Entry: 5tpc (more details), 2 Å

PDB Description: binding domain of bont/a complexed with ganglioside
PDB Compounds: (A:) Botulinum neurotoxin type A

SCOPe Domain Sequences for d5tpca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tpca1 b.29.1.6 (A:876-1079) automated matches {Clostridium botulinum [TaxId: 1491]}
tsilnlryesnhlidlsryaskinigskvnfdpidknqiqlfnlesskievilknaivyn
smyenfstsfwiripkyfnsislnneytiincmennsgwkvslnygeiiwtlqdtqeikq
rvvfkysqminisdyinrwifvtitnnrlnnskiyingrlidqkpisnlgnihasnnimf
kldgcrdthryiwikyfnlfdkel

SCOPe Domain Coordinates for d5tpca1:

Click to download the PDB-style file with coordinates for d5tpca1.
(The format of our PDB-style files is described here.)

Timeline for d5tpca1:

  • d5tpca1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-19