Lineage for d5t2ke_ (5t2k E:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2517142Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2517312Family d.58.4.10: Chlorite dismutase-like [110965] (2 protein domains)
    Pfam PF06778; duplication: consists of two similar domains; forms a pentamer similar to the MLI decamer
  6. 2517320Protein YwfI homologue [110966] (2 species)
  7. 2517327Species Geobacillus stearothermophilus [TaxId:272567] [328691] (1 PDB entry)
  8. 2517332Domain d5t2ke_: 5t2k E: [328717]
    automated match to d1t0tv_
    complexed with 76r

Details for d5t2ke_

PDB Entry: 5t2k (more details), 1.8 Å

PDB Description: geobacillus stearothermophilus hemq with manganese-coproporphyrin iii
PDB Compounds: (E:) Putative heme-dependent peroxidase GT50_08830

SCOPe Domain Sequences for d5t2ke_:

Sequence, based on SEQRES records: (download)

>d5t2ke_ d.58.4.10 (E:) YwfI homologue {Geobacillus stearothermophilus [TaxId: 272567]}
seaaqtldgwyclhdfrtidwsawktlpneereaaiseflalvdqwettesekqgshavy
tivgqkadilfmilrptldelheietalnktkladyllpaysyvsvvelsnylasgsedp
yqipevrrrlypilpktnyicfypmdkrrqgndnwymlsmeqrrelmrahgmtgrkyagk
vtqiitgsvglddfewgvtlfsddalqfkklvyemrfdevsarfgefgsffvgtrlpmen
vssffhv

Sequence, based on observed residues (ATOM records): (download)

>d5t2ke_ d.58.4.10 (E:) YwfI homologue {Geobacillus stearothermophilus [TaxId: 272567]}
seaaqtldgwyclhdfrtidwsawktlpneereaaiseflalvdqwettesekqgshavy
tivgqkadilfmilrptldelheietalnktkladyllpaysyvsvvelsnylipevrrr
lypilpktnyicfypmdkrrqgndnwymlsmeqrrelmrahgmtgrkyagkvtqiitgsv
glddfewgvtlfsddalqfkklvyemrfdevsarfgefgsffvgtrlpmenvssffhv

SCOPe Domain Coordinates for d5t2ke_:

Click to download the PDB-style file with coordinates for d5t2ke_.
(The format of our PDB-style files is described here.)

Timeline for d5t2ke_: