SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5t2ke_ (5t2k E:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2172847Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2173015Family d.58.4.10: Chlorite dismutase-like [110965] (2 protein domains)
    Pfam PF06778; duplication: consists of two similar domains; forms a pentamer similar to the MLI decamer
  6. 2173023Protein YwfI homologue [110966] (2 species)
  7. 2285390Species Geobacillus stearothermophilus [TaxId:272567] [328691] (1 PDB entry)
  8. 2285416Domain d5t2ke_: 5t2k E: [328717]
    automated match to d1t0tv_
    complexed with 76r

Details for d5t2ke_

PDB Entry: 5t2k (more details), 1.8 Å

PDB Description: geobacillus stearothermophilus hemq with manganese-coproporphyrin iii
PDB Compounds: (E:) Putative heme-dependent peroxidase GT50_08830

SCOPe Domain Sequences for d5t2ke_:

Sequence, based on SEQRES records: (download)

>d5t2ke_ d.58.4.10 (E:) YwfI homologue {Geobacillus stearothermophilus [TaxId: 272567]}
seaaqtldgwyclhdfrtidwsawktlpneereaaiseflalvdqwettesekqgshavy
tivgqkadilfmilrptldelheietalnktkladyllpaysyvsvvelsnylasgsedp
yqipevrrrlypilpktnyicfypmdkrrqgndnwymlsmeqrrelmrahgmtgrkyagk
vtqiitgsvglddfewgvtlfsddalqfkklvyemrfdevsarfgefgsffvgtrlpmen
vssffhv

Sequence, based on observed residues (ATOM records): (download)

>d5t2ke_ d.58.4.10 (E:) YwfI homologue {Geobacillus stearothermophilus [TaxId: 272567]}
seaaqtldgwyclhdfrtidwsawktlpneereaaiseflalvdqwettesekqgshavy
tivgqkadilfmilrptldelheietalnktkladyllpaysyvsvvelsnylipevrrr
lypilpktnyicfypmdkrrqgndnwymlsmeqrrelmrahgmtgrkyagkvtqiitgsv
glddfewgvtlfsddalqfkklvyemrfdevsarfgefgsffvgtrlpmenvssffhv

SCOPe Domain Coordinates for d5t2ke_:

Click to download the PDB-style file with coordinates for d5t2ke_.
(The format of our PDB-style files is described here.)

Timeline for d5t2ke_:

  • d5t2ke_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-19