SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5mrda_ (5mrd A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2199100Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2199101Protein automated matches [190417] (25 species)
    not a true protein
  7. 2199241Species Human (Homo sapiens) [TaxId:9606] [187294] (778 PDB entries)
  8. 2285409Domain d5mrda_: 5mrd A: [328710]
    automated match to d4aw1a_
    complexed with atp, dms, dtt, s26

Details for d5mrda_

PDB Entry: 5mrd (more details), 1.41 Å

PDB Description: human pdk1-pkciota kinase chimera in complex with allosteric compound ps267 bound to the pif-pocket
PDB Compounds: (A:) 3-phosphoinositide-dependent protein kinase 1

SCOPe Domain Sequences for d5mrda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mrda_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
skrpedfkfgkilgegsfstvvlarelatsreyaikivekrhvnkenkipyvqrekdvms
rldhpffvklyfcfqddeklyfglsyakngellkyirkigsfdetctrfytaeivsaley
lhgkgiihrdlkpenillnedmhiqitdfgtakvlspeskqaransfvgtaqyvspellt
eksackssdlwalgciiyqlvaglppfragneglifakiikleydfpekffpkardlvek
llvldatkrlgceemegygplkahpffesvtwenlhqqtppklt

SCOPe Domain Coordinates for d5mrda_:

Click to download the PDB-style file with coordinates for d5mrda_.
(The format of our PDB-style files is described here.)

Timeline for d5mrda_:

  • d5mrda_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-19