Lineage for d1eohd2 (1eoh D:1-76)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 180865Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
  4. 180866Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 181002Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)
  6. 181014Protein Glutathione S-transferase [52863] (27 species)
  7. 181085Species Human (Homo sapiens), class pi [TaxId:9606] [52864] (33 PDB entries)
  8. 181154Domain d1eohd2: 1eoh D:1-76 [32871]
    Other proteins in same PDB: d1eoha1, d1eohb1, d1eohc1, d1eohd1, d1eohe1, d1eohf1, d1eohg1, d1eohh1

Details for d1eohd2

PDB Entry: 1eoh (more details), 2.5 Å

PDB Description: glutathione transferase p1-1

SCOP Domain Sequences for d1eohd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eohd2 c.47.1.5 (D:1-76) Glutathione S-transferase {Human (Homo sapiens), class pi}
ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
tlyqsntilrhlgrtl

SCOP Domain Coordinates for d1eohd2:

Click to download the PDB-style file with coordinates for d1eohd2.
(The format of our PDB-style files is described here.)

Timeline for d1eohd2: