SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5i5pb1 (5i5p B:25-342)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2145531Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2145532Protein automated matches [190039] (136 species)
    not a true protein
  7. 2285225Species Uncultured marine [TaxId:56765] [328526] (2 PDB entries)
  8. 2285396Domain d5i5pb1: 5i5p B:25-342 [328697]
    Other proteins in same PDB: d5i5pa2, d5i5pb2
    automated match to d5im2a_
    complexed with br, peg, phb

Details for d5i5pb1

PDB Entry: 5i5p (more details), 1.6 Å

PDB Description: crystal structure of a marine metagenome trap solute binding protein specific for aromatic acid ligands (sorcerer ii global ocean sampling expedition, unidentified microbe, locus tag gos_1523157) in complex with co-purified 4-hydroxybenzoate
PDB Compounds: (B:) trap transporter solute binding protein

SCOPe Domain Sequences for d5i5pb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i5pb1 c.94.1.0 (B:25-342) automated matches {Uncultured marine [TaxId: 56765]}
evvlkfhsfppmpansnakfvkpwsekvlaesngeikveiypamqlggkppqlvdqvrdg
vvdivwtvagytpgrfphleafelpfmpasaeatsqalqeyvdtvaasdlkdykvlavfc
hapgkihtkekviksaadlngmkmrgptrvitkmleglgatpvgmpvpavagalskgvid
gmvvpweimpsfklheltkahttvsgsrglyttpflflmnkakyeslsdehkkvidnnag
lalaklagqlwdgfevparklaldaggtihslsggplaemkaageglekdwiksandrgl
dgamlvktakdliskydk

SCOPe Domain Coordinates for d5i5pb1:

Click to download the PDB-style file with coordinates for d5i5pb1.
(The format of our PDB-style files is described here.)

Timeline for d5i5pb1:

  • d5i5pb1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-19

View in 3D
Domains from same chain:
(mouse over for more information)
d5i5pb2