Lineage for d5ha8a_ (5ha8 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122006Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2122007Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) (S)
  5. 2122060Family c.33.1.0: automated matches [191389] (1 protein)
    not a true family
  6. 2122061Protein automated matches [190499] (22 species)
    not a true protein
  7. 2122108Species Microbacterium hydrocarbonoxydans [TaxId:273678] [328695] (3 PDB entries)
  8. 2122111Domain d5ha8a_: 5ha8 A: [328696]
    automated match to d3mcwa_

Details for d5ha8a_

PDB Entry: 5ha8 (more details), 2.05 Å

PDB Description: structure of a cysteine hydrolase
PDB Compounds: (A:) Isochorismatase

SCOPe Domain Sequences for d5ha8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ha8a_ c.33.1.0 (A:) automated matches {Microbacterium hydrocarbonoxydans [TaxId: 273678]}
prrtvvlaidlqagvtpgcfdeegvlsraaalveraraggvpvvwvhhdpvgvgtpewel
aaplhraegeplvrknyrdsfadttlretldelgathlvitgaqsdfcvrttmqraaaeg
ydvtlvsdahttvdtewegvrisgeqivahtnmyfsglrypgqefviathdhval

SCOPe Domain Coordinates for d5ha8a_:

Click to download the PDB-style file with coordinates for d5ha8a_.
(The format of our PDB-style files is described here.)

Timeline for d5ha8a_: