SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ha8a_ (5ha8 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2108002Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2108003Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) (S)
  5. 2108056Family c.33.1.0: automated matches [191389] (1 protein)
    not a true family
  6. 2108057Protein automated matches [190499] (21 species)
    not a true protein
  7. 2285394Species Microbacterium hydrocarbonoxydans [TaxId:273678] [328695] (3 PDB entries)
  8. 2285395Domain d5ha8a_: 5ha8 A: [328696]
    automated match to d3mcwa_

Details for d5ha8a_

PDB Entry: 5ha8 (more details), 2.05 Å

PDB Description: structure of a cysteine hydrolase
PDB Compounds: (A:) Isochorismatase

SCOPe Domain Sequences for d5ha8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ha8a_ c.33.1.0 (A:) automated matches {Microbacterium hydrocarbonoxydans [TaxId: 273678]}
prrtvvlaidlqagvtpgcfdeegvlsraaalveraraggvpvvwvhhdpvgvgtpewel
aaplhraegeplvrknyrdsfadttlretldelgathlvitgaqsdfcvrttmqraaaeg
ydvtlvsdahttvdtewegvrisgeqivahtnmyfsglrypgqefviathdhval

SCOPe Domain Coordinates for d5ha8a_:

Click to download the PDB-style file with coordinates for d5ha8a_.
(The format of our PDB-style files is described here.)

Timeline for d5ha8a_:

  • d5ha8a_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-19