Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
Fold c.47: Thioredoxin fold [52832] (3 superfamilies) |
Superfamily c.47.1: Thioredoxin-like [52833] (10 families) |
Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (3 proteins) |
Protein Glutathione S-transferase [52863] (24 species) |
Species Human (Homo sapiens), class pi [TaxId:9606] [52864] (30 PDB entries) |
Domain d1eohb2: 1eoh B:1-76 [32869] Other proteins in same PDB: d1eoha1, d1eohb1, d1eohc1, d1eohd1, d1eohe1, d1eohf1, d1eohg1, d1eohh1 |
PDB Entry: 1eoh (more details), 2.5 Å
SCOP Domain Sequences for d1eohb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eohb2 c.47.1.5 (B:1-76) Glutathione S-transferase {Human (Homo sapiens), class pi} ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl tlyqsntilrhlgrtl
Timeline for d1eohb2: