Lineage for d1eohb2 (1eoh B:1-76)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 70801Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 70802Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 70930Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (3 proteins)
  6. 70934Protein Glutathione S-transferase [52863] (24 species)
  7. 71005Species Human (Homo sapiens), class pi [TaxId:9606] [52864] (30 PDB entries)
  8. 71066Domain d1eohb2: 1eoh B:1-76 [32869]
    Other proteins in same PDB: d1eoha1, d1eohb1, d1eohc1, d1eohd1, d1eohe1, d1eohf1, d1eohg1, d1eohh1

Details for d1eohb2

PDB Entry: 1eoh (more details), 2.5 Å

PDB Description: glutathione transferase p1-1

SCOP Domain Sequences for d1eohb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eohb2 c.47.1.5 (B:1-76) Glutathione S-transferase {Human (Homo sapiens), class pi}
ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
tlyqsntilrhlgrtl

SCOP Domain Coordinates for d1eohb2:

Click to download the PDB-style file with coordinates for d1eohb2.
(The format of our PDB-style files is described here.)

Timeline for d1eohb2: