Lineage for d5hd8b_ (5hd8 B:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2225962Fold f.20: Clc chloride channel [81341] (1 superfamily)
    core: 18 transmembrane helices
  4. 2225963Superfamily f.20.1: Clc chloride channel [81340] (1 family) (S)
  5. 2225964Family f.20.1.1: Clc chloride channel [69912] (2 protein domains)
    duplication: consist of two similar structural parts
  6. 2226012Protein automated matches [226846] (4 species)
    not a true protein
  7. 2226040Species Escherichia coli [TaxId:216592] [255982] (2 PDB entries)
  8. 2285380Domain d5hd8b_: 5hd8 B: [328681]
    Other proteins in same PDB: d5hd8d1, d5hd8d2, d5hd8f1, d5hd8f2
    automated match to d3nmoa_
    complexed with cl

Details for d5hd8b_

PDB Entry: 5hd8 (more details), 3.15 Å

PDB Description: crystal structure of disulfide cross-linked d417c clc-ec1
PDB Compounds: (B:) H(+)/Cl(-) exchange transporter clcA

SCOPe Domain Sequences for d5hd8b_:

Sequence, based on SEQRES records: (download)

>d5hd8b_ f.20.1.1 (B:) automated matches {Escherichia coli [TaxId: 216592]}
rrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnypl
lltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffgglg
tlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplagi
lfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyli
lgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsgggf
nlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvave
lfpqyhleagtfaiagmgallaasirapltgiilvlemtcnyqlilpmiitglgatllaq
ftggkplysailartlakqea

Sequence, based on observed residues (ATOM records): (download)

>d5hd8b_ f.20.1.1 (B:) automated matches {Escherichia coli [TaxId: 216592]}
rrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnypl
lltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffgglg
tlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplagi
lfiieemrpqfrytlisikavfigvimstimyrifnklsdaplntlwlylilgiifgifg
pifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsgggfnlipiatag
nfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvavelfpqyhlea
gtfaiagmgallaasirapltgiilvlemtcnyqlilpmiitglgatllaqftggkplys
ailartlakqea

SCOPe Domain Coordinates for d5hd8b_:

Click to download the PDB-style file with coordinates for d5hd8b_.
(The format of our PDB-style files is described here.)

Timeline for d5hd8b_:

  • d5hd8b_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-19