SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2naza_ (2naz A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1984099Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 1984185Family a.4.6.0: automated matches [191513] (1 protein)
    not a true family
  6. 1984186Protein automated matches [190858] (17 species)
    not a true protein
  7. 2285378Species Acinetobacter baumannii [TaxId:575584] [328679] (1 PDB entry)
  8. 2285379Domain d2naza_: 2naz A: [328680]
    automated match to d4nhjb_

Details for d2naza_

PDB Entry: 2naz (more details)

PDB Description: the solution nmr structure of the c-terminal effector domain of bfmr from acinetobacter baumannii
PDB Compounds: (A:) Transcriptional regulatory protein RstA

SCOPe Domain Sequences for d2naza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2naza_ a.4.6.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 575584]}
edevaqriefddlvidnggrsvtlngelvdftsaeydllwllasnagrilsrediferlr
gieydgqdrsidvrisrirpkigddpenpkriktvrskgylfvketngl

SCOPe Domain Coordinates for d2naza_:

Click to download the PDB-style file with coordinates for d2naza_.
(The format of our PDB-style files is described here.)

Timeline for d2naza_:

  • d2naza_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-19