Lineage for d2naza_ (2naz A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1984099Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 1984185Family a.4.6.0: automated matches [191513] (1 protein)
    not a true family
  6. 1984186Protein automated matches [190858] (17 species)
    not a true protein
  7. 2285378Species Acinetobacter baumannii [TaxId:575584] [328679] (1 PDB entry)
  8. 2285379Domain d2naza_: 2naz A: [328680]
    automated match to d4nhjb_

Details for d2naza_

PDB Entry: 2naz (more details)

PDB Description: the solution nmr structure of the c-terminal effector domain of bfmr from acinetobacter baumannii
PDB Compounds: (A:) Transcriptional regulatory protein RstA

SCOPe Domain Sequences for d2naza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2naza_ a.4.6.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 575584]}
edevaqriefddlvidnggrsvtlngelvdftsaeydllwllasnagrilsrediferlr
gieydgqdrsidvrisrirpkigddpenpkriktvrskgylfvketngl

SCOPe Domain Coordinates for d2naza_:

Click to download the PDB-style file with coordinates for d2naza_.
(The format of our PDB-style files is described here.)

Timeline for d2naza_:

  • d2naza_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-19