Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) |
Family c.1.2.0: automated matches [191350] (1 protein) not a true family |
Protein automated matches [190292] (34 species) not a true protein |
Species Arabidopsis thaliana [TaxId:3702] [323630] (8 PDB entries) |
Domain d5lnwd_: 5lnw D: [328676] automated match to d3fema_ complexed with gol, hg3, k8p, rp5 |
PDB Entry: 5lnw (more details), 1.9 Å
SCOPe Domain Sequences for d5lnwd_:
Sequence, based on SEQRES records: (download)
>d5lnwd_ c.1.2.0 (D:) automated matches {Arabidopsis thaliana [TaxId: 3702]} pfsvkvglaqmlrggvimdvvnaeqariaeeagacavmalervpadiraqggvarmsdpq mikeikqavtipvmakarighfveaqileaigidyidesevltladedhhinkhnfripf vcgcrnlgealrriregaamirtkgeagtgniieavrhvrsvngdirvlrnmdddevftf akklaapydlvmqtkqlgrlpvvqfaaggvatpadaalmmqlgcdgvfvgsgifksgdpa rraraivqavthysdpemlvevscgl
>d5lnwd_ c.1.2.0 (D:) automated matches {Arabidopsis thaliana [TaxId: 3702]} pfsvkvglaqmlrggvimdvvnaeqariaeeagacavmalervpadiraqggvarmsdpq mikeikqavtipvmakarighfveaqileaigidyidesevltladedhhinkhnfripf vcgcrnlgealrriregaamirtkgeagtgniieavrhvrsvngdirvlrnmdddevftf akklaapydlvmqtkqlgrlpvvqfaaggvatpadaalmmqlgcdgvfvgsgifparrar aivqavthysdpemlvevscgl
Timeline for d5lnwd_: