Lineage for d5meva_ (5mev A:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2223824Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 2223896Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 2223897Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 protein domains)
    Pfam PF00452
  6. 2224027Protein automated matches [190236] (4 species)
    not a true protein
  7. 2224028Species Human (Homo sapiens) [TaxId:9606] [188722] (49 PDB entries)
  8. 2285363Domain d5meva_: 5mev A: [328664]
    Other proteins in same PDB: d5mevl1, d5mevl2
    automated match to d2kbwa_
    complexed with 7lw

Details for d5meva_

PDB Entry: 5mev (more details), 2.94 Å

PDB Description: mcl1 fab complex in complex with compound 21
PDB Compounds: (A:) Induced myeloid leukemia cell differentiation protein Mcl-1 homolog,Induced myeloid leukemia cell differentiation protein Mcl-1

SCOPe Domain Sequences for d5meva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5meva_ f.1.4.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddlyrqsleiisrylreqatgskdskplgeagaagrraletlrrvgdgvqrnhetafqgm
lrkldikneddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqesciepla
esitdvlvrtkrdwlvkqrgwdgfveffhve

SCOPe Domain Coordinates for d5meva_:

Click to download the PDB-style file with coordinates for d5meva_.
(The format of our PDB-style files is described here.)

Timeline for d5meva_:

  • d5meva_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-19