SCOPe 2.06: Domain d5hm6b_: 5hm6 B:

Lineage for d5hm6b_ (5hm6 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (71 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:470] [328556] (3 PDB entries)

8. Domain d5hm6b_: 5hm6 B: [328662]
   automated match to d5dcla_

Details for d5hm6b_

PDB Entry: 5hm6, 2 Å

PDB Description: n-terminal domain of bfmr from acinetobacter baumannii

PDB Compounds: (B:) BfmR

SCOPe Domain Sequences for d5hm6b_:

Sequence; same for both SEQRES and ATOM records:

>d5hm6b_ c.23.1.0 (B:) automated matches {Acinetobacter baumannii [TaxId: 470]}
klpkilivedderlarltqeylirnglevgvetdgnrairriiseqpdlvvldvmlpgad
gltvcrevrphyhqpilmltartedmdqvlglemgaddyvakpvqprvllarirallrr

Timeline for d5hm6b_:

• d5hm6b_ is new in SCOPe 2.06-stable
  
• d5hm6b_ appears in SCOPe 2.07
  
• d5hm6b_ appears in the current release, SCOPe 2.08