SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hm6b_ (5hm6 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2101601Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2101973Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2101974Protein automated matches [190131] (69 species)
    not a true protein
  7. 2285255Species Acinetobacter baumannii [TaxId:470] [328556] (1 PDB entry)
  8. 2285361Domain d5hm6b_: 5hm6 B: [328662]
    automated match to d5dcla_

Details for d5hm6b_

PDB Entry: 5hm6 (more details), 2 Å

PDB Description: n-terminal domain of bfmr from acinetobacter baumannii
PDB Compounds: (B:) BfmR

SCOPe Domain Sequences for d5hm6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hm6b_ c.23.1.0 (B:) automated matches {Acinetobacter baumannii [TaxId: 470]}
klpkilivedderlarltqeylirnglevgvetdgnrairriiseqpdlvvldvmlpgad
gltvcrevrphyhqpilmltartedmdqvlglemgaddyvakpvqprvllarirallrr

SCOPe Domain Coordinates for d5hm6b_:

Click to download the PDB-style file with coordinates for d5hm6b_.
(The format of our PDB-style files is described here.)

Timeline for d5hm6b_:

  • d5hm6b_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-19

View in 3D
Domains from other chains:
(mouse over for more information)
d5hm6a_