Lineage for d14gsa2 (14gs A:2-76)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 584500Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 584501Superfamily c.47.1: Thioredoxin-like [52833] (16 families) (S)
  5. 584721Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)
  6. 584951Protein Class pi GST [81358] (4 species)
  7. 584952Species Human (Homo sapiens) [TaxId:9606] [52864] (36 PDB entries)
  8. 585020Domain d14gsa2: 14gs A:2-76 [32866]
    Other proteins in same PDB: d14gsa1, d14gsb1

Details for d14gsa2

PDB Entry: 14gs (more details), 2.8 Å

PDB Description: glutathione s-transferase p1-1 apo form 1

SCOP Domain Sequences for d14gsa2:

Sequence, based on SEQRES records: (download)

>d14gsa2 c.47.1.5 (A:2-76) Class pi GST {Human (Homo sapiens)}
pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdlt
lyqsntilrhlgrtl

Sequence, based on observed residues (ATOM records): (download)

>d14gsa2 c.47.1.5 (A:2-76) Class pi GST {Human (Homo sapiens)}
pytvvyfpvrgrcaalrmlladqgqswkeevvtvyqlpkfqdgdltlyqsntilrhlgrt
l

SCOP Domain Coordinates for d14gsa2:

Click to download the PDB-style file with coordinates for d14gsa2.
(The format of our PDB-style files is described here.)

Timeline for d14gsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d14gsa1