SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5lyjf1 (5lyj F:1-76)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2106806Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2106807Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2107090Family c.30.1.9: Tubulin tyrosine ligase (TTL) N-terminal domain-like [310625] (1 protein)
  6. 2107091Protein Tubulin tyrosine ligase (TTL) N-terminal domain [310727] (2 species)
  7. 2107092Species Chicken (Gallus gallus) [TaxId:9031] [311384] (33 PDB entries)
  8. 2285358Domain d5lyjf1: 5lyj F:1-76 [328659]
    Other proteins in same PDB: d5lyja1, d5lyja2, d5lyjb1, d5lyjb2, d5lyjc1, d5lyjc2, d5lyjd1, d5lyjd2, d5lyje_, d5lyjf2, d5lyjf3
    automated match to d3tiia1
    complexed with 7ba, acp, ca, gdp, gol, gtp, mes, mg

Details for d5lyjf1

PDB Entry: 5lyj (more details), 2.4 Å

PDB Description: tubulin-combretastatin a4 complex
PDB Compounds: (F:) Uncharacterized protein

SCOPe Domain Sequences for d5lyjf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lyjf1 c.30.1.9 (F:1-76) Tubulin tyrosine ligase (TTL) N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq
lvnyyrgadklcrkas

SCOPe Domain Coordinates for d5lyjf1:

Click to download the PDB-style file with coordinates for d5lyjf1.
(The format of our PDB-style files is described here.)

Timeline for d5lyjf1:

  • d5lyjf1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-19